인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha(IL15 & IL15RA),partial(Active)
Recombinant Human Interleukin-15 & Interleukin-15 receptor subunit alpha(IL15 & IL15RA),partial(Active)
제품코드 : CSB-AP004671HU
제품정보 : Cancer
- Size: 1mg/500ug/50ug/10ug
- Express system: Mammalian cell
- Species: Homo sapiens (Human)
- Tag Info: C-terminal hFc-tagged
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined in a cell proliferation assay using CTLL?2 mouse cytotoxic T cells is less than 20 ng/ml. |
| Target Names | IL15 & IL15RA |
| Uniprot No. | Q13261 |
| Research Area | Cancer |
| Alternative Names | AA690181; CD215; I15RA_HUMAN; IL 15R alpha; IL-15 receptor subunit alpha; IL-15R-alpha; IL-15RA; Il15ra; Interleukin 15 receptor alpha ; Interleukin 15 receptor subunit alpha; MGC104179; sIL-15 receptor subunit alpha; sIL-15R-alpha; sIL-15RA; Soluble interleukin 15 receptor subunit alpha; Soluble interleukin-15 receptor subunit alpha |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 31-96aa & 49-162aa(N120D) |
| Complete Sequence | ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRD & NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANDSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Mol. Weight | 46.9 kDa |
| Protein Length | Heterodimer |
| Tag Info | C-terminal hFc-tagged |
| Form | Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered PBS,5% Trehalose,ph7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |