인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Interferon gamma(IFNG) (Active)
Recombinant Human Interferon gamma(IFNG) (Active)
제품코드 : CSB-AP004201HU
제품정보 : Immunology
- Size: 1mg/500ug/50ug/10ug
- Express system: E.coli
- Species: Homo sapiens (Human)
- Tag Info: Tag-Free
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Activity | The ED50 as determined by a viral resistance assay using HT-29 cells is 17 pg/mL |
| Target Names | IFNG |
| Uniprot No. | P01579 |
| Research Area | Immunology |
| Alternative Names | IF 1; IFG; IFI; IFN gamma; IFN immune; IFN, immune; IFN-gamma; IFNG; IFNG_HUMAN; Immune interferon; Interferon gamma; Type II Interferon |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 24-166aa |
| Complete Sequence | QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
| Mol. Weight | 16.88 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | Tag-Free |
| Form | Liquid or Lyophilized powder |
| Buffer | Lyophilized from a 0.2 μm filtered solution of 20mM Sodium Succinate, 5%Mannitol, 0.1%Tween80, 5%Trehalose,1mM TCEP, pH4.0. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged. |
| Datasheet & COA | Please contact us to get it. |