인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-YP023924HU
제품정보 : Cancer
Description | The recombinant active human Transmembrane protease serine 2 (TMPRSS2) is produced by the expression of a target DNA sequence with 6xHis, N-terminal tag(s), in the yeast expression system. The target DNA sequence encodes the 106-492aa region of the human TMPRSS2. The purity of this partial-length protein is greater than 85% determined by SDS-PAGE. The gel showed a molecular weight band of about 45 kDa under reducing conditions. And its enzymatic activity was verified by its ability to cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC) (Km is 21.93μM). The protease TMPRSS2 plays an impo...Read more |
Purity | Greater than 85% as determined by SDS-PAGE. |
Activity | ①Recombinant Human TMPRSS2 His tag protein (CSB-YP023924HU) enzyme activity is measured by its ability to cleave fluorogenic peptide substrate(Boc-Gln-Ala-Arg-AMC), The Km is 21.93μM. ②Measured by Camostat Mesylate inhibit ratio on TMPRSS2 (CSB-YP023924HU), which can cleave fluorogenic peptide substrate (Boc-Gln-Ala-Arg-AMC). The Camostat Mesylate inhibit EC50 is 0.03347-0.07945μM. |
Target Names | TMPRSS2 |
Uniprot No. | O15393 |
Research Area | Cancer |
Alternative Names | TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10 |
Species | Homo sapiens (Human) |
Source | Yeast |
Expression Region | 106-492 aa |
Target Protein Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
Mol. Weight | 44.8kDa |
Protein Length | Partial |
Tag Info | N-terminal 6xHis-tagged |
Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Tris-based buffer,50% glycerol |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs | Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |