인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Macaca fascicularis Alpha-synuclein(SNCA)
Recombinant Macaca fascicularis Alpha-synuclein(SNCA)
제품코드 : CSB-YP021912MOV
제품정보 : Others
- Size: 500μg/100μg/20μg
- Express system: Yeast
- Species: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
- Tag Info: N-terminal 6xHis-tagged
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | The DNA fragment encoding the 1-140aa of the Macaca fascicularis SNCA protein was fused with N-terminal 6xHis tag gene and then was inserted into the expression vector, which was subsequently transfected into the yeast cells for expression. The resulting product was further purified to obtain the recombinant Macaca fascicularis SNCA protein. The purity of this recombinant SNCA protein is greater than 90% assessed by Bandscan software analysis combined with SDS-PAGE. This recombinant SNCA protein showed a band on the gel with a molecular weight of approximately 17 kDa.In light of recent discove...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | SNCA |
| Uniprot No. | P61142 |
| Research Area | Others |
| Alternative Names | SNCA; Alpha-synuclein |
| Species | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Source | Yeast |
| Expression Region | 1-140aa |
| Target Protein Sequence | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 16.5kDa |
| Protein Length | Full Length |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |