인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-YP015007MO1
제품정보 : Others
Description | CUSABIO synthesized the recombinant gene by integrating the N-terminal 6xHis tag sequence into the targeted gene encoding the 111-291aa of the mouse Ms4a1. The synthesized gene was subsequently cloned into an expression vector. After cloning, the expression vector was introduced into the yeast for expression. The product was purified to obtain the recombinant mouse Ms4a1 protein carrying N-terminal 6xHis tag. The SDS-PAGE assayed the purity of this recombinant Ms4a1 protein greater than 90%. This Ms4a1 protein migrated along the gel to a band of about 21 kDa molecular weight.B-lymphocyte antig...Read more |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | Ms4a1 |
Uniprot No. | P19437 |
Research Area | Others |
Alternative Names | Ms4a1; Cd20; Ly-44; Ms4a2; B-lymphocyte antigen CD20; B-cell differentiation antigen Ly-44; Lymphocyte antigen 44; Membrane-spanning 4-domains subfamily A member 1; CD antigen CD20 |
Species | Mus musculus (Mouse) |
Source | Yeast |
Expression Region | 111-291aa |
Target Protein Sequence | VIMSSLSLFAAISGIILSIMDILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNSSEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLVTAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKMKEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEINFPAPPQEQESLPVENEIAP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 22.3kDa |
Protein Length | Partial |
Tag Info | N-terminal 6xHis-tagged |
Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs | Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |