인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partia
Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partia
제품코드 : CSB-YP004931MO
제품정보 : Immunology
- Size: 500μg/100μg/20μg
- Express system: Yeast
- Species: Mus musculus (Mouse)
- Tag Info: N-terminal 6xHis-tagged
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | Yeast-expressed T-cell surface glycoprotein CD3 epsilon chain (Cd3e) CSB-YP004931MO is a recombinant fusion protein of partial Cd3e coupled to a 6xHis-tag at the N-terminus. This protein consists of the extracellular domain (23-108aa) of mouse Cd3e and has a calculated molecular weight of 11.9 kDa. Its identity was validated by the LC-MS/MS analysis. The SDS-PAGE showed an observed Cd3e protein molecular mass of about 14.5-16 kDa. The purity of this protein is over 90%. In-stock Cd3e proteins are offered now. Except for specific antibody synthesis, this recombinant Cd3e protein also may be use...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | Cd3e |
| Uniprot No. | P22646 |
| Research Area | Immunology |
| Alternative Names | Cd3eT-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e |
| Species | Mus musculus (Mouse) |
| Source | Yeast |
| Expression Region | 23-108aa |
| Target Protein Sequence | DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 11.9 kDa |
| Protein Length | Extracellular Domain |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Tris-based buffer,50% glycerol |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |