인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Deoxyribonuclease gamma(DNASE1L3)
Recombinant Human Deoxyribonuclease gamma(DNASE1L3)
제품코드 : CSB-EP621686HUe1
제품정보 : Others
- Size: 1mg/100μg/20μg
- Express system: E.coli
- Species: Homo sapiens (Human)
- Tag Info: Tag-Free
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | The synthesis of this Recombinant Human DNASE1L3 protein depends on the utilization of recombinant DNA technology to a large degree. DNA sequences that encoded the DNASE1L3 protein could be inserted into a vector and introduced into an expression host, E.coli, where it could be easily expressed in and purified from. The expression of this DNASE1L3 protein was at 21-305aa. The purity is 85%+ determined by SDS-PAGE.DNASE1L3 is a gene providing an instruction of making a protein named deoxyribonuclease gamma (DNASE1L3) in human. The protein encoded by this gene is also known as DNase I homolog pr...Read more |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Target Names | DNASE1L3 |
| Uniprot No. | Q13609 |
| Research Area | Others |
| Alternative Names | Deoxyribonuclease gamma; Deoxyribonuclease I like 3; Deoxyribonuclease I like III; Deoxyribonuclease I-like 3; DHP 2; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I like 3; DNase I-like 3; DNASE1L3; DNSL3_HUMAN; Liver and spleen DNase; LS DNase; LS-DNase; LSD; SLEB 16; SLEB16 |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 21-305aa |
| Target Protein Sequence | MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 33.4 kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | Tag-Free |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |