인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Mouse Serum amyloid A-3 protein(Saa3)
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
제품코드 : CSB-EP361411MO
제품정보 : Others
- Size: 1mg/100μg/20μg
- Express system: E.coli
- Species: Mus musculus (Mouse)
- Tag Info: N-terminal 6xHis-tagged
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | The preparation of this recombinant Mouse Saa3 protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a Saa3 fragment (20-122aa) that could be translated into the Saa3 protein and then transferred it into E.coli cells to express the recombinant Saa3 protein molecule. In order to get the target protein with high purity, N-terminal 6xHis tag was used in the production. The purity is 90% determined by SDS-PAGE. And the activity has been verified.Serum amyloid A3 (Saa3) derives mainly from extrahepatic tissue and is not detected in plasma from moderately...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | Saa3 |
| Uniprot No. | P04918 |
| Research Area | Others |
| Alternative Names | Saa3; Serum amyloid A-3 protein |
| Species | Mus musculus (Mouse) |
| Source | E.coli |
| Expression Region | 20-122aa |
| Target Protein Sequence | RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 15.8kDa |
| Protein Length | Full Length of Mature Protein |
| Tag Info | N-terminal 6xHis-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |