인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
We Serving the Health and Biotechnology of Humanity
제품코드 : CSB-EP005386HUc2
제품정보 : Neuroscience
Description | The cDNA sequence encoding the extracellular domain (21-255AA) of human acetylcholine receptor subunit alpha (CHRNA1) was fused with an N-terminal 6xHis-Trx-tag and then expressed in E.coli. The product, recombinant fusion protein, was measured the purity of over 90% using SDS-PAGE. The gel showed an about 75-85 kDa molecular mass band of this protein under reducing conditions. This recombinant CHRNA1 protein may be used in the specific antibody synthesis or the studies of the neuroscience research area. In-stock recombinant CHRNA1 protein is offered now. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | CHRNA1 |
Uniprot No. | P02708 |
Research Area | Neuroscience |
Alternative Names | Acetylcholine receptor subunit alpha; ACHA_HUMAN; AChR; ACHRA; ACHRD; CHNRA; Cholinergic receptor nicotinic alpha 1 subunit; Cholinergic receptor nicotinic alpha polypeptide 1; Cholinergic receptor; nicotinic; alpha polypeptide 1 (muscle); Chrna1; CMS1A; CMS1B; CMS2A; FCCMS; Nicotinic cholinergic receptor alpha 1; SCCMS; Schizophrenia neurophysiologic defect candidate |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 21-255aa |
Target Protein Sequence | SEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 44.1kDa |
Protein Length | Extracellular Domain |
Tag Info | N-terminal 6xHis-Trx-tagged |
Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs | Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |