인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Claudin-6(CLDN6)-VLPs (Active)
Recombinant Human Claudin-6(CLDN6)-VLPs (Active)
제품코드 : CSB-MP005508HU(A4)
제품정보 : Cancer
- Size: 100ug/20ug
- Express system: Mammalian cell
- Species: Homo sapiens (Human)
- Tag Info: C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | This Human Claudin-6 (CLDN6) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human CLDN6 (1-220aa) was expressed with the C-terminal 10xHis tag. The activity was validated by its binding ability in a functional ELISA. This Human CLDN6 recombinant protein was developed through the Virus-Like Particles (VLPs) Platform. It is a four-pass transmembrane protein.CLDNs are a class of TJ (Tight junctions) transmembrane proteins. From the perspective of spatial structure, most CLDNs contain four transmembrane regions and two extracellular loops, and a...Read more |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 10 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU), the EC50 is 1.501-2.035 ng/mL |
| Target Names | CLDN6 |
| Uniprot No. | P56747 |
| Alternative Names | (Skullin) |
| Molecular Characterization | .svg) |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 1-220aa |
| Target Protein Sequence | MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV |
| Mol. Weight | 25.1 kDa |
| Protein Length | Full Length |
| Tag Info | C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions) |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |