인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Somatostatin receptor type 2(SSTR2)-VLPs (Active)
Recombinant Human Somatostatin receptor type 2(SSTR2)-VLPs (Active)
제품코드 : CSB-MP022725HU
제품정보 : Cancer
- Size: 100ug/20ug
- Express system: Mammalian cell
- Species: Homo sapiens (Human)
- Tag Info: C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions)
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | This Human SSTR2 recombinant protein was produced in mammalian cell, where the gene sequence encoding Human SSTR2 (1-369aa) was expressed with the C-terminal 6xHis tag. The activity of this recombinant protein was measured in a functional ELISA. In addition, this recombinant human SSTR2 protein was developed through the Virus-Like Particles (VLPs) Platform. It is a seven-pass transmembrane protein.SSTR2 (Somatostatin receptor 2) is a subtype of the SSTR family, which belong to the G protein-coupled receptor (GPCR) superfamily. SSTR2 is mainly involved in the regulation of various neuroendocrin...Read more |
| Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
| Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 μg/mL can bind Anti-SSTR2 recombinant antibody (CSB-RA022725MA01HU), the EC50 is 58.13-81.28 ng/mL.②Blocking experiment on Anti-SSTR2 antibody (CSB-RA022725MA01HU) between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells (CSB-SC022725HU) by Flow cytometry. |
| Target Names | SSTR2 |
| Uniprot No. | P30874 |
| Alternative Names | (SS-2-R)(SS2-R)(SS2R)(SRIF-1) |
| Molecular Characterization |  |
| Species | Homo sapiens (Human) |
| Source | Mammalian cell |
| Expression Region | 1-369aa |
| Target Protein Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| Mol. Weight | 42.5 kDa |
| Protein Length | Full Length |
| Tag Info | C-terminal 6xHis-tagged (This tag can be tested only under denaturing conditions) |
| Form | Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. |
| Datasheet & COA | Please contact us to get it. |