인류의 건강과 생명공학 발전을 위해 봉사하는 기업 드림셀
We Serving the Health and Biotechnology of Humanity
홈 > 제품정보 > 시약 > 해외 공식 대리점 > Recombinant Human Androgen receptor(AR) ,partial
Recombinant Human Androgen receptor(AR) ,partial
제품코드 : CSB-EP001975HU
제품정보 : Signal Transduction
- Size: 1mg/100ug/20ug
- Express system: E.coli
- Species: Homo sapiens (Human)
- Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
제품문의
-
- 전화번호
- 2292-8870
- 이메일
- dreamcell@dreamcell.co.kr
제품상세
Product Details
| Description | A target DNA sequence encoding to the 551-919aa of human Androgen receptor (AR) was fused with an N-terminal 10xHis-SUMO-tag and a C-terminal Myc-tag and then expressed in the E.coli. The resulting protein is a partial-length recombinant AR protein. It got purified by the SDS-PAGE analysis over 90% in purity. The SDS-PAGE of this AR protein gave a 55-66 kDa band. The in-stock protein allows it to reach your lab bench faster. This recombinant AR protein may be applied to generate specific antibodies and in the AR-related signal transduction research. AR belonging to the steroid hormone nuclear ...Read more |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Target Names | AR |
| Uniprot No. | P10275 |
| Research Area | Signal Transduction |
| Alternative Names | AIS; ANDR_HUMAN; Androgen nuclear receptor variant 2; Androgen receptor (dihydrotestosterone receptor; testicular feminization; spinal and bulbar muscular atrophy; Kennedy disease); Androgen receptor; androgen receptor splice variant 4b; AR; AR8; DHTR; Dihydro testosterone receptor; Dihydrotestosterone receptor (DHTR); Dihydrotestosterone receptor; HUMARA; HYSP1; KD; Kennedy disease (KD); NR3C4; Nuclear receptor subfamily 3 group C member 4 (NR3C4); Nuclear receptor subfamily 3 group C member 4; SBMA; SMAX1; Spinal and bulbar muscular atrophy (SBMA); Spinal and bulbar muscular atrophy; Testicular Feminization (TFM); TFM |
| Species | Homo sapiens (Human) |
| Source | E.coli |
| Expression Region | 551-919aa |
| Target Protein Sequence | DYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
| Mol. Weight | 62.4kDa |
| Protein Length | Partial |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
| Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Troubleshooting and FAQs | Protein FAQs |
| Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Lead Time | 3-7 business days |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Datasheet & COA | Please contact us to get it. |